logo
Loading...
H₂-driven biocatalysis for flavin-dependent ene-reduction in a continuous closed-loop flow system utilizing H₂ from water electrolysis
ChemistryCommunications Chemistry

H₂-driven biocatalysis for flavin-dependent ene-reduction in a continuous closed-loop flow system utilizing H₂ from water electrolysis

G. Lim, D. Calabrese, et al.

Discover the groundbreaking research conducted by Guiyeoul Lim, Donato Calabrese, Allison Wolder, Paul R. F. Cordero, Dörte Rother, Florian F. Mulks, Caroline E. Paul, and Lars Lauterbach on a scalable electro-driven flow system, leveraging immobilized enzymes for superior flavin-dependent biocatalysis. This innovative approach showcases notable efficiency in converting ketoisophorone to levodione, promising a sustainable solution for fine chemical synthesis.... show more
Abstract
Despite the increasing demand for efficient and sustainable chemical processes, the development of scalable systems using biocatalysis for fine chemical production remains a significant challenge. We have developed a scalable flow system using immobilized enzymes to facilitate flavin-dependent biocatalysis, targeting as a proof-of-concept asymmetric alkene reduction. The system integrates a flavin-dependent Old Yellow Enzyme (OYE) and a soluble hydrogenase to enable H₂-driven regeneration of the OYE cofactor FMNH₂. Molecular hydrogen was produced by water electrolysis using a proton exchange membrane (PEM) electrolyzer and introduced into the flow system via a designed gas membrane addition module at a high diffusion rate. The flow system shows remarkable stability and reusability, consistently achieving >99% conversion of ketoisophorone to levodione. It also demonstrates versatility and selectivity in reducing various cyclic enones and can be extended to further flavin-based biocatalytic approaches and gas-dependent reactions. This electro-driven continuous flow system, therefore, has significant potential for advancing sustainable processes in fine chemical synthesis.
Publisher
Communications Chemistry
Published On
Sep 07, 2024
Authors
Guiyeoul Lim, Donato Calabrese, Allison Wolder, Paul R. F. Cordero, Dörte Rother, Florian F. Mulks, Caroline E. Paul, Lars Lauterbach
Tags
biocatalysisflavin-dependentasymmetric reductionelectrolysissustainable chemistryenzymescontinuous flow system
Listen, Learn & Level Up
Over 10,000 hours of research content in 25+ fields, available in 22+ languages.
No more digging through PDFs, just hit play and absorb the world's latest research in your language, on your time.
listen to research audio papers with researchbunny